Protein coding transcript 103665

• Transcript: Ll_transcript_289919
• CDS coordinates: 93-461 (+)
• Peptide sequence: MEQVSGPVVVADGMAGAAMYELVRVGRDNLIGEIIRLEGDSATIQVYEETAGLMVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIAKRSGDVYIPRGVSVPALDKDTLWEFQPKKIGM*
• ORF Type: complete

Annotations of Ll_transcript_289919

• Blastp: V-type proton ATPase catalytic subunit A from Vigna with 97.52% of identity
• Blastx: V-type proton ATPase catalytic subunit A from Vigna with 97.52% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414699.1)
• Pfam: ATP synthase alpha/beta family, beta-barrel domain (PF02874.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;