Protein coding transcript 103801

• Transcript: Ll_transcript_287763
• CDS coordinates: 1306-1893 (+)
• Peptide sequence: MCAIKEVRVVCDDQSSKECLKQLNQEINLLSQLSHPNIVQYYGSDLGDEALSVYLEFVSGGSIHKLLQEYGSFGEPVIQNYTRQIVSGLSYLHGRNTVHRDIKGANILVDPNGEIKLADFGMAKHINSSASMLSFKGSPYWMAPEVVMNTNGYSLPVDIWSLGCTILEMAMSKPPWSQYEGVAAIFKIGNSKDMPE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_287763

• Blastp: Mitogen-activated protein kinase kinase kinase 3 from Arabidopsis with 39.29% of identity
• Blastx: Mitogen-activated protein kinase kinase kinase 3 from Arabidopsis with 82.13% of identity
• Eggnog: mitogen-activated protein kinase kinase kinase(ENOG410XQGS)
• Kegg: Link to kegg annotations (AT1G53570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415082.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;