Transcript | Ll_transcript_287763 |
---|---|
CDS coordinates | 1306-1893 (+) |
Peptide sequence | MCAIKEVRVVCDDQSSKECLKQLNQEINLLSQLSHPNIVQYYGSDLGDEALSVYLEFVSGGSIHKLLQEYGSFGEPVIQNYTRQIVSGLSYLHGRNTVHRDIKGANILVDPNGEIKLADFGMAKHINSSASMLSFKGSPYWMAPEVVMNTNGYSLPVDIWSLGCTILEMAMSKPPWSQYEGVAAIFKIGNSKDMPE |
ORF Type | 3prime_partial |
Blastp | Mitogen-activated protein kinase kinase kinase 3 from Arabidopsis with 39.29% of identity |
---|---|
Blastx | Mitogen-activated protein kinase kinase kinase 3 from Arabidopsis with 82.13% of identity |
Eggnog | mitogen-activated protein kinase kinase kinase(ENOG410XQGS) |
Kegg | Link to kegg annotations (AT1G53570) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415082.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer