Protein coding transcript 103817

• Transcript: Ll_transcript_289808
• CDS coordinates: 2-796 (+)
• Peptide sequence: SNKSLFFGILCNVLAPVLLLPHLIFYLTASSNPILKCRLKIFFPIAFLAFSVMVPVNWTNRTLERSNLTYSSIDKLSMSNIPLGSNRFWTHLVMAYAFTFWTCYILKREYHIVATMRLHFLASERRRPDQFTVLVRNVPPDADESVSELVEHFFLVNHADYYLTHKVVYDAKQLSSLVAKKKKNQNWLDYYQLKYSRSKSVRPTKKTGFLGLCGNKVDAMDFYTTEIEKLSKEIELERDKLMKDPKSIMPAAFVSFRSRWGAAVC
• ORF Type: internal

Annotations of Ll_transcript_289808

• Blastp: Calcium permeable stress-gated cation channel 1 from Arabidopsis with 69.7% of identity
• Blastx: Calcium permeable stress-gated cation channel 1 from Arabidopsis with 69.7% of identity
• Eggnog: transmembrane protein 63C(COG5594)
• Kegg: Link to kegg annotations (AT4G22120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461627.1)
• Pfam: Late exocytosis, associated with Golgi transport (PF13967.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;