Protein coding transcript 103825

• Transcript: Ll_transcript_289797
• CDS coordinates: 192-1145 (+)
• Peptide sequence: MASLGDIGLSAAINLLSAFVFLVAFAILRIQPINDRVYFPKWYMKGLRSSPLHSRAFVGKFVNLDFTSYVKFLNWMPAALQMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIAFLAFSVMVPVNWTNNTLARSNLTYSSIDKLSISNIPLGSNRFWTHLVMAYAFTFWTCYILKREYEVVATMRLHFLASQRRRPDQFTVIVRNVPPDADESVSELVEHFFLVNHPDHYLTHQVVYNAKKLSSLVAKKKKMQNWLDYYQLKHSRNQSARPTKRVHRSGSFELKIVFHFEFGFSISFLLSLFKPFHFIIFLPLFYSSG*
• ORF Type: complete

Annotations of Ll_transcript_289797

• Blastp: CSC1-like protein At1g11960 from Arabidopsis with 74.36% of identity
• Blastx: CSC1-like protein At1g11960 from Arabidopsis with 74.36% of identity
• Eggnog: transmembrane protein 63C(COG5594)
• Kegg: Link to kegg annotations (AT1G11960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434074.1)
• Pfam: Late exocytosis, associated with Golgi transport (PF13967.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;