Transcript | Ll_transcript_289799 |
---|---|
CDS coordinates | 192-1682 (+) |
Peptide sequence | MASLGDIGLSAAINLLSAFVFLVAFAILRIQPINDRVYFPKWYMKGLRSSPLHSRAFVGKFVNLDFTSYVKFLNWMPAALQMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIAFLAFSVMVPVNWTNNTLARSNLTYSSIDKLSISNIPLGSNRFWTHLVMAYAFTFWTCYILKREYEVVATMRLHFLASQRRRPDQFTVIVRNVPPDADESVSELVEHFFLVNHPDHYLTHQVVYNAKKLSSLVAKKKKMQNWLDYYQLKHSRNQSARPTKRTGFLGLCGSKVDAMEFYITEIDKLSKDIELEREKVVQNPKSIMPAAFVSFRTRWGAAVCAQTQQTKNPTIWLTEWAPEPRDVYWDNMAIPYVSLTIRRLIIFVAFFFLTFFFMIPIAFVQSLANIEGIEKAAPFLKPFIEINFIKSLIQGFLPGIALKLFLIFLPTILMIMSRFEGFISLSGLERRAATRYYIFQFINVFLGSIITGSAFQQLDKFINQSANQ* |
ORF Type | complete |
Blastp | Calcium permeable stress-gated cation channel 1 from Arabidopsis with 74.8% of identity |
---|---|
Blastx | Calcium permeable stress-gated cation channel 1 from Arabidopsis with 74.8% of identity |
Eggnog | transmembrane protein 63C(COG5594) |
Kegg | Link to kegg annotations (AT4G22120) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434074.1) |
Pfam | Late exocytosis, associated with Golgi transport (PF13967.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer