Protein coding transcript 10386

• Transcript: Ll_transcript_432871
• CDS coordinates: 38-940 (+)
• Peptide sequence: MEIGRENEIEDISMSPPSGSNDFGHNKEFLSQAYLRTRYTEIDIQVEGSSFNQNRPLPIFLKFEDVEYKVRSSQAVSDNPVKTMVSKVATQLTIEEDRYKKILKGITGSIGPGEILALMGPSGSGKTTLLRVISGRLQENTKGKITYNDVPYTPAVKRRIGFVAQEDVLFPQLTVEETLVFSALLRLPTNMSKQQKYAKVDTTIKELGLERCRGTKIGGGFLKGISGGERKRTSIGYEILVDPSLLLLDEPTSGLDSTSANKLLLTLQGLAKAGRTIITTIHQPSSRIFHNNTPAIQQNLS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_432871

• Blastp: ABC transporter G family member 26 from Arabidopsis with 71.09% of identity
• Blastx: ABC transporter G family member 26 from Arabidopsis with 71.09% of identity
• Eggnog: (ABC) transporter(COG1131)
• Kegg: Link to kegg annotations (AT3G13220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429439.1)
• Pfam: ABC transporter (PF00005.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;