Protein coding transcript 103870

• Transcript: Ll_transcript_287868
• CDS coordinates: 872-1267 (+)
• Peptide sequence: MQVKIFGIRGCCFGIANMILVKRMRETLYSSLLLQDISFFDTETVGDLTSRLGADCQQVSRVIGNDINLILRNFLQGTGSLIYLLTLSWQLGLSTLLICSILAAVMLRYGRYQKKLARLIQEVTASANEVE*
• ORF Type: complete

Annotations of Ll_transcript_287868

• Blastp: ABC transporter B family member 26, chloroplastic from Arabidopsis with 55.64% of identity
• Blastx: ABC transporter B family member 26, chloroplastic from Arabidopsis with 73.48% of identity
• Eggnog: (ABC) transporter(COG1132)
• Kegg: Link to kegg annotations (AT1G70610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020216424.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;