Protein coding transcript 103878

• Transcript: Ll_transcript_287856
• CDS coordinates: 2380-2976 (+)
• Peptide sequence: MVNLLLRLYEPTNGQILIDGIPLKNLDVKWWRERIGYVGQEPKLFRMDISSNIRYGCTRDVKQEDIEWAAKQAYAHDFIAALPNGYETLVDDDLLSGGQKQRIAIARALLRDPKILILDEATSALDAESEHNVKGVLRSVRSDSHSRRSVIVIAHRLSTIQTADRIVVMDCGQVVEVGNCLFISNALNILNLFASLPM*
• ORF Type: complete

Annotations of Ll_transcript_287856

• Blastp: ABC transporter B family member 26, chloroplastic from Arabidopsis with 81.56% of identity
• Blastx: ABC transporter B family member 26, chloroplastic from Arabidopsis with 67.46% of identity
• Eggnog: (ABC) transporter(COG1132)
• Kegg: Link to kegg annotations (AT1G70610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006574634.1)
• Pfam: ABC transporter (PF00005.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;