Transcript | Ll_transcript_288874 |
---|---|
CDS coordinates | 2-829 (+) |
Peptide sequence | SKCADGRRIGDWKSVLREVDAAIASGADSSPPLFMCRAEALLKLHQIDDAESILSHSPKSEWHTNSSSQARFFGMLSEAYSYFIKAQIEMVLGRFESAVAAAEKACQIDSRNVEAAVLLNNVRMVTRARMRGNDLFKSERFTEACSAYGEGLKLDPSNSVLYCNRAACWFKLGQWEKSIEDCNQALLIQPNYAKALLRRAASNSKLERWEEAVKDYEVLRRDHPNDNDVAEALFHAQVALKKSRGEEVSNLKFGGEVEEVSSLEQFRAAISLPGN* |
ORF Type | 5prime_partial |
Blastp | TPR repeat-containing thioredoxin TTL1 from Arabidopsis with 69.58% of identity |
---|---|
Blastx | TPR repeat-containing thioredoxin TTL1 from Arabidopsis with 69.6% of identity |
Eggnog | TPR repeat-containing thioredoxin(ENOG410ZSQA) |
Kegg | Link to kegg annotations (AT1G53300) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425252.1) |
Pfam | Tetratricopeptide repeat (PF13181.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer