Protein coding transcript 103948

• Transcript: Ll_transcript_288875
• CDS coordinates: 424-1251 (+)
• Peptide sequence: MRRIGEWKSVLREVDAAIASGADSSPPLFMCRAEALLKLHQIDDAESILSHSPKSEWHTNSSSQARFFGMLSEAYSYFIKAQIEMVLGRFESAVAAAEKACQIDSRNVEAAVLLNNVRMVTRARMRGNDLFKSERFTEACSAYGEGLKLDPSNSVLYCNRAACWFKLGQWEKSIEDCNQALLIQPNYAKALLRRAASNSKLERWEEAVKDYEVLRRDHPNDNDVAEALFHAQVALKKSRGEEVSNLKFGGEVEEVSSLEQFRAAISLPGVSIVQFG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_288875

• Blastp: TPR repeat-containing thioredoxin TTL1 from Arabidopsis with 68.98% of identity
• Blastx: TPR repeat-containing thioredoxin TTL1 from Arabidopsis with 68.47% of identity
• Eggnog: TPR repeat-containing thioredoxin(ENOG410ZSQA)
• Kegg: Link to kegg annotations (AT1G53300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425252.1)
• Pfam: Tetratricopeptide repeat (PF13181.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;