Transcript | Ll_transcript_287381 |
---|---|
CDS coordinates | 734-1552 (+) |
Peptide sequence | MKENVDSPVTVLEDYFRSSDSETSSSKDPTVYSESQDISKPASKWHAFFQLMRSKSKKPVPTLHPLNGLKLSKRFSRSMRENMLPSCLLDATLSSPCKSPWKIFRNHDILLATNHFSQENLIGKGGYAEVYKGCLPNQQVVAIKRSTRGSADEKIGDFLSELGVMAHVNHPNTAKLVGYGVDGGMHLVLELSEKGSLASVLYGSKEKLAWFTRQKIALGTAKGILYLHEGCQRRIIHRDIKAANILLTQDYEPQVPFMTATATLHLNTCFMV* |
ORF Type | complete |
Blastp | Receptor-like cytosolic serine/threonine-protein kinase RBK2 from Arabidopsis with 50.46% of identity |
---|---|
Blastx | Receptor-like cytosolic serine/threonine-protein kinase RBK2 from Arabidopsis with 50.46% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT3G05140) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426767.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer