Protein coding transcript 104160

• Transcript: Ll_transcript_287392
• CDS coordinates: 540-1142 (+)
• Peptide sequence: MKEKVESESPVTVLEDYFRSSDSDTSSSKDPTLDSESHDISKPSSKWRNIFRMLRRSKKHVPTLHLSKRMNRSMRERILPDCLFGATLSAPSRSQWNIFTNHEILLATNHFSQENLIGKGGYAEVYQGCLPNNNQVVAIKRLTRGTTDEIISDFLSELGVMAHVDHPNIAKLVGYGVDGGMHLVLELSEKGSLASMLYGK*
• ORF Type: complete

Annotations of Ll_transcript_287392

• Blastp: Receptor-like cytosolic serine/threonine-protein kinase RBK2 from Arabidopsis with 43.27% of identity
• Blastx: Receptor-like cytosolic serine/threonine-protein kinase RBK2 from Arabidopsis with 44.18% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT3G05140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451237.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;