Protein coding transcript 104163

• Transcript: Ll_transcript_287384
• CDS coordinates: 1484-1933 (+)
• Peptide sequence: MAHVDHPNIAKLVGYGVDGGMHLVLELSEKGSLASMLYGSKENLPWCIRQKIALGTAKGILYLHEGCQRRIIHRDIKAANILLTEDYEPQICDFGLAKWLPENWSHHTIAKFEGTFGYLAPEYLLHGIVDEKTDVFAFGVLLLELVSGRR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_287384

• Blastp: Receptor-like cytosolic serine/threonine-protein kinase RBK2 from Arabidopsis with 71.81% of identity
• Blastx: Receptor-like cytosolic serine/threonine-protein kinase RBK2 from Arabidopsis with 64.09% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT3G05140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015951049.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;