| Transcript | Ll_transcript_287411 |
|---|---|
| CDS coordinates | 97-399 (+) |
| Peptide sequence | MEWDKLWTINKKIIDPVCPRHTAVIAERRVLLTLTDGPEKPFVRIIPRHKKYEAAGDKATTYTKRVWIDYADAETIAAGEEVTLMDWGNAIVEQIEKDQDG |
| ORF Type | 3prime_partial |
| Blastp | Glutamate--tRNA ligase, cytoplasmic from Arabidopsis with 74.26% of identity |
|---|---|
| Blastx | Glutamate--tRNA ligase, cytoplasmic from Arabidopsis with 76.11% of identity |
| Eggnog | Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu) (By similarity)(COG0008) |
| Kegg | Link to kegg annotations (AT5G26710) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019452319.1) |
| Pfam | tRNA synthetases class I (E and Q), anti-codon binding domain (PF03950.17) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer