Protein coding transcript 104354

• Transcript: Ll_transcript_288609
• CDS coordinates: 1197-1622 (+)
• Peptide sequence: MLDRMEKVDLSCTYSKVKIIGALLCVLGALTMSVMSSISISATNKEATIQLLSSPTDSFFDREKIFGCLYLLAAVCILSSNIILQVTHHQITMKKEQFTLKKVVVLAGFYSRRFSGACVLMRDNGLFWCMHDCNSSITSRS*
• ORF Type: complete

Annotations of Ll_transcript_288609

• Blastp: WAT1-related protein At5g47470 from Arabidopsis with 50.6% of identity
• Blastx: WAT1-related protein At5g47470 from Arabidopsis with 50.6% of identity
• Eggnog: auxin-induced protein(ENOG410YAMV)
• Kegg: Link to kegg annotations (AT5G47470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434882.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;