Protein coding transcript 104408

• Transcript: Ll_transcript_289788
• CDS coordinates: 85-486 (+)
• Peptide sequence: MSMFMVYWIYSDCLMQELNSDWQQSATRLLVAIGSHLPDLMMEEIFLHLSGTNAALPAMVQILAEFASTDPLQFIPRWKGVLSRILPILGNVRDMHRPIFANAFKCWCQAAWQYSTDFPSHFPLGGDVIAGHF*
• ORF Type: complete

Annotations of Ll_transcript_289788

• Blastp: Protein SHOOT GRAVITROPISM 6 from Arabidopsis with 70.43% of identity
• Blastx: Protein SHOOT GRAVITROPISM 6 from Arabidopsis with 70.43% of identity
• Eggnog: Heat repeat(ENOG410XQE8)
• Kegg: Link to kegg annotations (AT2G36810)
• CantataDB: Link to cantataDB annotations (CNT0002789)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016208039.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;