Protein coding transcript 104425

• Transcript: Ll_transcript_289379
• CDS coordinates: 254-640 (+)
• Peptide sequence: MILNRFSEGKMGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEVKCSI*
• ORF Type: complete

Annotations of Ll_transcript_289379

• Blastp: ADP-ribosylation factor from Zea with 100% of identity
• Blastx: ADP-ribosylation factor from Zea with 100% of identity
• Eggnog: GTP-binding Protein(COG1100)
• Kegg: Link to kegg annotations (732812)
• CantataDB: Link to cantataDB annotations (CNT0001084)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004489257.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;