Protein coding transcript 1045

• Transcript: Ll_transcript_530832
• CDS coordinates: 2-580 (+)
• Peptide sequence: SLFNQFIIETLSGTPTVKDDKLVSEVQKLQNAGVAIPPGLRASAFPKIKSEVLKSETSTNKVATDQDNGITIDHLHKLNPKNVSAWHMKRLINMVRHGALTTLDEQILDDSTTRGDESAKQIRSENEAKAAAKKIFHNVARSGSRYIYLEDLMHFMREDEAFKTITLFEGASETNKISKSALKNWVVNAFRER
• ORF Type: internal

Annotations of Ll_transcript_530832

• Blastp: Mechanosensitive ion channel protein 8 from Arabidopsis with 56.72% of identity
• Blastx: Mechanosensitive ion channel protein 8 from Arabidopsis with 56.72% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT2G17010)
• CantataDB: Link to cantataDB annotations (CNT0000406)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438255.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;