Protein coding transcript 104655

• Transcript: Ll_transcript_382073
• CDS coordinates: 171-830 (+)
• Peptide sequence: MQLPSTGVTSRSHVNNRGSALGAIATNEPAEAGPYDPLIGKKVWTRWPDDNHFYEAVITDYNSVEGRHALVYDINSADETWEWVNLKEILPEDIRWEGEDPDPRIPHKGGRPGSGRGMKRSVSGGGAITDAGRGRGITKAQPKKDFTLSQNGSRKKPAGDIEILHTDTLIKEVERIFSASHPDPMEMEKAKKVLKEHEQALVNAIARLGDVSDGESGNN*
• ORF Type: complete

Annotations of Ll_transcript_382073

• Blastp: Protein EMSY-LIKE 3 from Arabidopsis with 62.39% of identity
• Blastx: Protein EMSY-LIKE 3 from Arabidopsis with 62.56% of identity
• Eggnog: Chromosome 11 open reading frame 30(ENOG410YF3T)
• Kegg: Link to kegg annotations (AT5G13020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428770.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;