Transcript | Ll_transcript_381945 |
---|---|
CDS coordinates | 326-1003 (+) |
Peptide sequence | MDSARDGVVVAGTVLIPMRFVWPYGGRSVYLSGSFTRWSELLQMSPVEGCPSVFQVIHSLAPGYHQYKFYVDGEWRHDEHQPYMSGEFGIVNTVLLATDPNFIPSLPPDIASGSNMDVDNEVFRRVVRLTDVSLSDVLPRISDVDLQMSRQRISAFLSMRTAYELLPESGKVVALDVDLPVKQAFHILHEQGIPVAPLWDFCKGQFVGVLSALDFILILKEVFAI* |
ORF Type | complete |
Blastp | Sucrose nonfermenting 4-like protein from Arabidopsis with 65.47% of identity |
---|---|
Blastx | Sucrose nonfermenting 4-like protein from Arabidopsis with 64.04% of identity |
Eggnog | Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate- limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth (By similarity)(COG0517) |
Kegg | Link to kegg annotations (AT1G09020) |
CantataDB | Link to cantataDB annotations (CNT0002298) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464293.1) |
Pfam | Glycogen recognition site of AMP-activated protein kinase (PF16561.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer