Protein coding transcript 104686

• Transcript: Ll_transcript_381963
• CDS coordinates: 696-1154 (+)
• Peptide sequence: MKILQNEVSTVPIVHSSSEDGSFPQLLHLASLSGILKCICRYFRHCSSSLPILQLPICAIPVGTWVPKIGESNRPPLAMLRPSAPLASALNLLVQAQVSSIPIVDDTDTLLDIYCRSDITALAKDRAYTHMNLDGMTVHQVCFIFSIPIKFH*
• ORF Type: complete

Annotations of Ll_transcript_381963

• Blastp: Sucrose nonfermenting 4-like protein from Arabidopsis with 75% of identity
• Blastx: Sucrose nonfermenting 4-like protein from Arabidopsis with 64.04% of identity
• Eggnog: Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate- limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth (By similarity)(COG0517)
• Kegg: Link to kegg annotations (AT1G09020)
• CantataDB: Link to cantataDB annotations (CNT0002298)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464292.1)
• Pfam: CBS domain (PF00571.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;