Protein coding transcript 104717

• Transcript: Ll_transcript_380682
• CDS coordinates: 1160-1462 (+)
• Peptide sequence: MCDRAYPKKLAFQYLEDLRNEFERVNGSQIETAARPYAFIKFDTFIQKTKKLYQDTHTQRNIAKLNDELYEVHQIMTRNVQEVLGVGEQLDRKIFLVFPE*
• ORF Type: complete

Annotations of Ll_transcript_380682

• Blastp: 25.3 kDa vesicle transport protein from Arabidopsis with 92.39% of identity
• Blastx: 25.3 kDa vesicle transport protein from Arabidopsis with 86.73% of identity
• Eggnog: Vesicle-associated membrane protein(COG5143)
• Kegg: Link to kegg annotations (AT1G11890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430415.1)
• Pfam: Regulated-SNARE-like domain (PF13774.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;