Protein coding transcript 104794

• Transcript: Ll_transcript_380100
• CDS coordinates: 3148-3636 (+)
• Peptide sequence: MQDQFYDAIAGESSSDEESDDDEKLDQKGSIVKLKNVSWAFSTLALKRTAAPDLSEELDPNVTPIRIQLSDFHGSLHKRKDDNDTNCWASPSGKGFMIRGKNYLKDNHKVVGGDPLLHLIAVDWFTVNKSVDKIALHPKCLVQVKLNLLDFISLIFLLDYYY*
• ORF Type: complete

Annotations of Ll_transcript_380100

• Blastp: Protein ENHANCED DISEASE RESISTANCE 2 from Arabidopsis with 39.74% of identity
• Blastx: Protein ENHANCED DISEASE RESISTANCE 2 from Arabidopsis with 39.74% of identity
• Eggnog: Domain containing protein, expressed(ENOG4112846)
• Kegg: Link to kegg annotations (AT4G19040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453200.1)
• Pfam: Protein of unknown function (DUF1336) (PF07059.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;