Protein coding transcript 1048

• Transcript: Ll_transcript_325305
• CDS coordinates: 3-335 (+)
• Peptide sequence: KKQYDVFISFRGEDTRKSFISHLHYELCKANIKAYIDVNLKKGGKLWPALSKAILDSDCHFFKKLCYFEMVLGRTGQILQCRSSKSHGQVVIPVFYGVDPSHIRNQSGCYR
• ORF Type: internal

Annotations of Ll_transcript_325305

• Blastp: Disease resistance protein TAO1 from Arabidopsis with 38.94% of identity
• Blastx: Disease resistance protein TAO1 from Arabidopsis with 38.94% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT5G44510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433712.1)
• Pfam: TIR domain (PF01582.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;