Protein coding transcript 104800

• Transcript: Ll_transcript_380107
• CDS coordinates: 82-567 (+)
• Peptide sequence: MDSPVERGKFEYFGWVYHLGVNSIGHQYCHLRFLFIRGKYVAMYKRDPHEHPSIDPIRKGIVGPTLMVEELGRRKVNSGDLYVLRFYNRLDEAKKGEIACATAGEVQGWIEAFDQAKQQAEYELSRRGSARDKLNMEDEYVCLHLKYTILLSDRLTLVECC*
• ORF Type: complete

Annotations of Ll_transcript_380107

• Blastp: Protein ENHANCED DISEASE RESISTANCE 2 from Arabidopsis with 25.89% of identity
• Blastx: Protein ENHANCED DISEASE RESISTANCE 2 from Arabidopsis with 25.89% of identity
• Eggnog: Domain containing protein, expressed(ENOG4112846)
• Kegg: Link to kegg annotations (AT4G19040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453200.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;