Protein coding transcript 104807

• Transcript: Ll_transcript_380082
• CDS coordinates: 2775-3263 (+)
• Peptide sequence: MQDQFYDAIAGESSSDEESDDDEKLDQKGSIVKLKNVSWAFSTLALKRTAAPDLSEELDPNVTPIRIQLSDFHGSLHKRKDDNDTNCWASPSGKGFMIRGKNYLKDNHKVVGGDPLLHLIAVDWFTVNKSVDKIALHPKCLVQVKLNLLDFISLIFLLDYYY*
• ORF Type: complete

Annotations of Ll_transcript_380082

• Blastp: Protein ENHANCED DISEASE RESISTANCE 2-like from Arabidopsis with 28.85% of identity
• Blastx: Protein ENHANCED DISEASE RESISTANCE 2 from Arabidopsis with 39.74% of identity
• Eggnog: Domain containing protein, expressed(ENOG4112846)
• Kegg: Link to kegg annotations (AT5G45560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453200.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;