Protein coding transcript 104892

• Transcript: Ll_transcript_381326
• CDS coordinates: 447-1493 (+)
• Peptide sequence: MADRTLAVVKPIWMKQAEEAKIKSEAEKDAAAKAAFEATFKGLEKNCERGTVLSDSESEEYEDLVKKPIGPVDPAKCTAAGTGIAGGAAGAPSSFTVVTKDADERKVSTGGALIKVKVVPGLGVGGAEHEGVVKDMGDGTYTITYVVPKRGNYMVNVECNGKPIMGSPFPVFFSAGSSSGGLLGLTPASTFPNLVNQNQTTMPNMPNYSGSVSGAFPGLLGMIPGILAGPSGGATLPGFGASLGEICRDYLNGHCAKADCKLNHPQHNLLMAALAATTSMGTLSQAPMAPSAAAMAAAQAIVAAQALQAHAAQSAKDSTGMLCAILILCCTAVCSLLAISFMMNGFSC*
• ORF Type: complete

Annotations of Ll_transcript_381326

• Blastp: -
• Blastx: Polyadenylate-binding protein-interacting protein 8 from Arabidopsis with 31.58% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463292.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;