Protein coding transcript 104929

• Transcript: Ll_transcript_381526
• CDS coordinates: 2885-3523 (+)
• Peptide sequence: MPFLCFFCYNLMIKILNVDILCYSSLFDLKVLLSFYLHNSITVIFFAKEGEGCILTPMKEDSLPPVTANFQQGLGQKFKQPAGTGIDFSIFEESELLKVTDMDVYPLAVKADASSHDGDGSNETPTSGSTNLQITQAVFEKEKGEFLVKVVKQILWVNGMRYELQEIYGIGSSVESDLDGNDPGKECVICLSEPRDTTVLPCRHMVFYSFTF*
• ORF Type: complete

Annotations of Ll_transcript_381526

• Blastp: Probable E3 ubiquitin-protein ligase LOG2 from Arabidopsis with 66.09% of identity
• Blastx: Probable E3 ubiquitin-protein ligase LOG2 from Arabidopsis with 62.96% of identity
• Eggnog: RING finger(ENOG410XRAE)
• Kegg: Link to kegg annotations (AT3G09770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432624.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;