Protein coding transcript 104932

• Transcript: Ll_transcript_381531
• CDS coordinates: 121-1110 (+)
• Peptide sequence: MGNVGSNNRVNNRRRSSSSARRIHPPPVRPQPEIAANQFIYPAAATTPHHNYPEYFPPPPMWGRYQQPRPQPQLQLQPPPMPYVEHQKAVTIRNDVNIKKETLKIEPDEKNPRCFVVSFMFDATVDGSITIIFFAKEGECCILTPMKEKTLPPVTVNFQKGLGQKFKQPAGTGIDFSVFEESDLFKVSDMDVYPLAVKADASSRDDDGSNETQTSGKTNSQITQAVFEKEKGELHVKVVKQILWVNGIRYELQEIFGIGNSVESDLDENDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPIERLLEIKVGSEE*
• ORF Type: complete

Annotations of Ll_transcript_381531

• Blastp: Probable E3 ubiquitin-protein ligase LOG2 from Arabidopsis with 67.29% of identity
• Blastx: Probable E3 ubiquitin-protein ligase LOG2 from Arabidopsis with 71.49% of identity
• Eggnog: RING finger(ENOG410XRAE)
• Kegg: Link to kegg annotations (AT3G09770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432270.1)
• Pfam: Zinc finger, C3HC4 type (RING finger) (PF13920.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;