Protein coding transcript 105

• Transcript: Ll_transcript_470978
• CDS coordinates: 3-437 (+)
• Peptide sequence: PLAIFIVCLLSLSRAKASSNIGVNYGQLGNNLPSPYRSIELLTTMNAGRVKLYDSNPEILRLLSTSKIQVSIMIQNHEIAGIASNQSIADEWVRNNILPYYPGTKIRYLLVGNEVLSYSSEQGHQMWHDLVPAMKNIKRSFKAQN
• ORF Type: internal

Annotations of Ll_transcript_470978

• Blastp: Probable glucan endo-1,3-beta-glucosidase A6 from Arabidopsis with 56% of identity
• Blastx: Probable glucan endo-1,3-beta-glucosidase A6 from Arabidopsis with 56% of identity
• Eggnog: maternal effect embryo arrest 48(ENOG41113FY)
• Kegg: Link to kegg annotations (AT4G14080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416287.1)
• Pfam: Glycosyl hydrolases family 17 (PF00332.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;