Protein coding transcript 1050

• Transcript: Ll_transcript_325288
• CDS coordinates: 2-478 (+)
• Peptide sequence: STSAVKKAGAAVAPKKPTQPKKVSTGVKKPAPKKMVLKGKGQKKKKVSLKFTVDCTNPVEDNIMDVANFEKYLAERIKVNGKLNNFGNAVSLERHKMKIGVSSEIPFSKRYLKYLTKRYLKKNNLRDWLRVVATSKDTYELRYFQINSQDDDDDEDND*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_325288

• Blastp: 60S ribosomal protein L22 from Sophophora with 70.73% of identity
• Blastx: 60S ribosomal protein L22 from Silurana with 76.53% of identity
• Eggnog: Ribosomal protein(ENOG4111UVJ)
• Kegg: Link to kegg annotations (Dmel_CG7434)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016205560.1)
• Pfam: Ribosomal L22e protein family (PF01776.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;