Protein coding transcript 105029

• Transcript: Ll_transcript_381662
• CDS coordinates: 1-417 (+)
• Peptide sequence: NNLPLVPSLGVHHDMTLPLSHYFIYTGHNSYLTGNQLSSDCSDVPIIHALKRGVRVIELDIWPNSSKDNVDVLHGRTLTTPVELIRCLRAIKEHAFVASEFPVVITLEDHLTPDLQAKVAEVSYNLLVVLLGFKMLTI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_381662

• Blastp: Phosphoinositide phospholipase C 7 from Arabidopsis with 74.62% of identity
• Blastx: Phosphoinositide phospholipase C 7 from Arabidopsis with 74.62% of identity
• Eggnog: phospholipase c(ENOG410XPSW)
• Kegg: Link to kegg annotations (AT3G55940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433607.1)
• Pfam: Phosphatidylinositol-specific phospholipase C, X domain (PF00388.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;