Transcript | Ll_transcript_381666 |
---|---|
CDS coordinates | 487-876 (+) |
Peptide sequence | MVHGHSVIAPNNISRSKETQKDSVSVYMGEGWYYDFKHTHFDQYSPPHFYTRVGIAGVPYDNVMKKTKTIEDNWLPTWNEVFEFPLYVPELALLRIEVHEYDIYENDDFGGQTVLPVWDKKRNSSYSTV* |
ORF Type | complete |
Blastp | Phosphoinositide phospholipase C 2 from Arabidopsis with 82.29% of identity |
---|---|
Blastx | Phosphoinositide phospholipase C 2 from Arabidopsis with 82.29% of identity |
Eggnog | phospholipase c(ENOG410XPSW) |
Kegg | Link to kegg annotations (AT3G08510) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455811.1) |
Pfam | C2 domain (PF00168.29) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer