Protein coding transcript 105040

• Transcript: Ll_transcript_381649
• CDS coordinates: 107-415 (+)
• Peptide sequence: MGEGWYYDFKHTHFDQYSPPHFYTRVGIAGVPYDNVMKKTKTIEDNWLPTWNEVFEFPLYVPELALLRIEVHEYDIYENDDFGGQTVLPVWDKKRNSSYSTV*
• ORF Type: complete

Annotations of Ll_transcript_381649

• Blastp: Phosphoinositide phospholipase C 2 from Arabidopsis with 82.61% of identity
• Blastx: Phosphoinositide phospholipase C 2 from Arabidopsis with 78.43% of identity
• Eggnog: phospholipase c(ENOG410XPSW)
• Kegg: Link to kegg annotations (AT3G08510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455811.1)
• Pfam: C2 domain (PF00168.29)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;