Transcript | Ll_transcript_381655 |
---|---|
CDS coordinates | 182-751 (+) |
Peptide sequence | MHGAQMVAFNMQGYGRSLWLMHGMFKANGGCGYVKKPDFLLKTGPDNEVFDPKAKLSVKTTLKVTVYMGEGWYYDFKHTHFDQYSPPDFYTRVGIAGVPDDTVMKRTKAIEDNWLPTWNEVFEFPLTIPELALLRIEVHEYDMSEKDDFGGQTVLPVWELRSGIRAVPLYSQKGEKYNSVKLLMHFEFY* |
ORF Type | complete |
Blastp | Phosphoinositide phospholipase C 2 from Arabidopsis with 82.35% of identity |
---|---|
Blastx | Phosphoinositide phospholipase C 2 from Arabidopsis with 82.41% of identity |
Eggnog | phospholipase c(ENOG410XPSW) |
Kegg | Link to kegg annotations (AT3G08510) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433607.1) |
Pfam | Phosphatidylinositol-specific phospholipase C, Y domain (PF00387.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer