Transcript | Ll_transcript_381433 |
---|---|
CDS coordinates | 181-954 (+) |
Peptide sequence | MPPPFMAPLSSPPSLPPLKSDYISRSSKNRRFSDLRGLQWRINLGILPSSTSIDDLRRVTADSRRRYARLRKRLLVEPHITKDGSRSPPDLVMDNPLSQNPDSTWSHFFRSAELERMVDQDLSRLYPEHGNYFQTTGCQGMLRRILLLWCLRHPECGYRQGMHELIAPLVYVLQVDLERLSEVRKLYEDLFLDRLDGLLCQRNDLCYSFDLRKSQDLEGETGSHGNSMKVNSLDELDPEIQTIVLLSDAYGAEGELGI |
ORF Type | 3prime_partial |
Blastp | TBC1 domain family member 5 homolog A from Dictyostelium with 31.07% of identity |
---|---|
Blastx | TBC1 domain family member 5 from Homo with 33.55% of identity |
Eggnog | TBC1 domain family, member 5(ENOG410YX8Z) |
Kegg | Link to kegg annotations (DDB_G0280253) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415545.1) |
Pfam | Rab-GTPase-TBC domain (PF00566.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer