Protein coding transcript 105077

• Transcript: Ll_transcript_381415
• CDS coordinates: 502-1020 (+)
• Peptide sequence: MDNPLSQNPDSTWSRYFRNAELERMVDQDLSRLYPEHGSYFQTPGCQGTLRRILLLWCLRHPECGYRQGMHELLAPLLYVLQVDVESHSDVRKLYEDHFTDRFDGLFCQENDLSYNFDFRKSPDLMDDEIGSHGNAMKIKTLDELDPKIRTIVLLSDAYGAEGELGIVLSEKF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_381415

• Blastp: TBC1 domain family member 5 from Homo with 39.29% of identity
• Blastx: TBC1 domain family member 5 from Mus with 32.46% of identity
• Eggnog: TBC1 domain family, member 5(ENOG410YX8Z)
• Kegg: Link to kegg annotations (9779)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463526.1)
• Pfam: Rab-GTPase-TBC domain (PF00566.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;