Transcript | Ll_transcript_382403 |
---|---|
CDS coordinates | 3-410 (+) |
Peptide sequence | SVEPAETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGYDKEKKELDPEVHRKYIFGGHVANYIKTLIEDEPEKYQTHFSEYIKRGIEADGLEALYKKVHAAIRADPTAKKSAKQPPKEHKR* |
ORF Type | 5prime_partial |
Blastp | 60S ribosomal protein L5 from Cucumis with 84.44% of identity |
---|---|
Blastx | 60S ribosomal protein L5 from Cucumis with 84.44% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (101216379) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456191.1) |
Pfam | Ribosomal large subunit proteins 60S L5, and 50S L18 (PF17144.3) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer