| Transcript | Ll_transcript_382379 |
|---|---|
| CDS coordinates | 1-408 (+) |
| Peptide sequence | GGLDIPHSDKRFAGFDKEKKELDPEVHRKYIFGAHVANYMKTLIEDEPEKYQTHFSEYIKRGIEADGLEALYKKVHAAIRADPTAKKSGKQPPKEHKRYNLKKLTYDERKNKLIARLQALNSAAGVDDDDDEDDE* |
| ORF Type | 5prime_partial |
| Blastp | 60S ribosomal protein L5 from Cucumis with 79.03% of identity |
|---|---|
| Blastx | 60S ribosomal protein L5 from Cucumis with 79.03% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (101216379) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019456191.1) |
| Pfam | Ribosomal L18 C-terminal region (PF14204.5) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer