Protein coding transcript 105101

• Transcript: Ll_transcript_382393
• CDS coordinates: 1-405 (+)
• Peptide sequence: GGLDIPHSDKRFAGFDKEKKELDPEVHRKYIFGAHVANYMKTLIEDEPEKYQTHFSEYIKRGIEADGLEALYKKVHAAIRADPTAKKSGKQPPKEHKRYNLKKLTYEERKNKLIARLQALNSAAGAGDDDEDDE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_382393

• Blastp: 60S ribosomal protein L5 from Cucumis with 78.23% of identity
• Blastx: 60S ribosomal protein L5 from Cucumis with 77.87% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (101216379)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456191.1)
• Pfam: Ribosomal L18 C-terminal region (PF14204.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;