Protein coding transcript 105114

• Transcript: Ll_transcript_381232
• CDS coordinates: 16-648 (+)
• Peptide sequence: MKIGPTMDPTVTWDPPSLFLSPKHYIHECFFFSSPFSPFSTSTMAPSSLLSNTFLSPIHLPSSNSSHPKPSFLNFPTNTFRSLTHSKNTTNPTPFTTFCSSDSPKDDSSIPIESRYPAFPTVMDINQIREILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFFPGHFPERPIMPGVLMVEVVNTMLILHFLLLSFFVFPISYYIYVL*
• ORF Type: complete

Annotations of Ll_transcript_381232

• Blastp: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ from Janthinobacterium with 56.58% of identity
• Blastx: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ from Janthinobacterium with 56.58% of identity
• Eggnog: Involved in unsaturated fatty acids biosynthesis. Catalyzes the dehydration of short chain beta-hydroxyacyl-ACPs and long chain saturated and unsaturated beta-hydroxyacyl-ACPs (By similarity)(COG0764)
• Kegg: Link to kegg annotations (mma_2047)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426358.1)
• Pfam: FabA-like domain (PF07977.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;