Protein coding transcript 105165

• Transcript: Ll_transcript_382245
• CDS coordinates: 2-514 (+)
• Peptide sequence: DFVLVGSGWWLFIWMVFRCIFMGSSFFTFTSEFVLVQHYDRRGQYETALSKINEAIEHTPTVIDLYSAKSRILKHAGDLAAAAALADEARCMDLADRYVNSECVKRMLQADQVALAEKTAVLFTKDGDQHNNLHDMQCMWYELASAESYDRQGDLGLALKKFLAVEKHYAD
• ORF Type: internal

Annotations of Ll_transcript_382245

• Blastp: N-terminal acetyltransferase A complex auxiliary subunit NAA15 from Arabidopsis with 85.61% of identity
• Blastx: N-terminal acetyltransferase A complex auxiliary subunit NAA15 from Arabidopsis with 85.61% of identity
• Eggnog: NatA auxiliary subunit(ENOG410XR7D)
• Kegg: Link to kegg annotations (AT1G80410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457563.1)
• Pfam: NMDA receptor-regulated protein 1 (PF12569.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;