Protein coding transcript 105274

• Transcript: Ll_transcript_381840
• CDS coordinates: 1271-1987 (+)
• Peptide sequence: MVSEKYVVDLNKPLVSQVGHLGEDYDDWVHQPIVSKEGPRFFGSNYLEFFTRTVWWVIPIVWVPVASWFISNSVRMGLAGPHVALFVVIGIFVWTFAEYMLHRFLFHVKTKSYWGNTLHYLLHGCHHKHPMDGLRLVFPPAAAAILATPIWNLVKLICTPSNAPAIFGGILLGYVMYDCTHYYLHHGQPKTNMPKNLKKYHLNHHYRLWNYGFGITSPLWDFVFGTVPPPSKAGTKRQ*
• ORF Type: complete

Annotations of Ll_transcript_381840

• Blastp: Dihydroceramide fatty acyl 2-hydroxylase FAH1 from Arabidopsis with 67.23% of identity
• Blastx: Dihydroceramide fatty acyl 2-hydroxylase FAH1 from Arabidopsis with 67.23% of identity
• Eggnog: fatty acid hydroxylase(COG3000)
• Kegg: Link to kegg annotations (AT2G34770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462568.1)
• Pfam: Fatty acid hydroxylase superfamily (PF04116.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;