Transcript | Ll_transcript_381867 |
---|---|
CDS coordinates | 1056-1496 (+) |
Peptide sequence | MVSEKYVVDLNKPLVSQVGHLGEDYDDWVHQPIVSKEGPRFFGSNYLEFFTRTVWWVIPIVWVPVASWFISNSVRMGLAGPHVALFVVIGIFVWTFAEYMLHRFLFHVKTKSYWLDLCYRSSYLLRLTTYSLKWHCKFCSFVYLIA* |
ORF Type | complete |
Blastp | Dihydroceramide fatty acyl 2-hydroxylase FAH1 from Arabidopsis with 61.34% of identity |
---|---|
Blastx | Dihydroceramide fatty acyl 2-hydroxylase FAH1 from Arabidopsis with 53.69% of identity |
Eggnog | fatty acid hydroxylase(COG3000) |
Kegg | Link to kegg annotations (AT2G34770) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462568.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer