Protein coding transcript 105280

• Transcript: Ll_transcript_381849
• CDS coordinates: 1766-2092 (+)
• Peptide sequence: MDGLRLVFPPAAAAILATPIWNLVKLICTPSNAPAIFGGILLGYVMYDCTHYYLHHGQPKTNMPKNLKKYHLNHHYRLWNYGFGITSPLWDFVFGTVPPPSKAGTKRQ*
• ORF Type: complete

Annotations of Ll_transcript_381849

• Blastp: Dihydroceramide fatty acyl 2-hydroxylase FAH1 from Arabidopsis with 59.69% of identity
• Blastx: Dihydroceramide fatty acyl 2-hydroxylase FAH1 from Arabidopsis with 70.16% of identity
• Eggnog: fatty acid hydroxylase(COG3000)
• Kegg: Link to kegg annotations (AT2G34770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447739.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;