Protein coding transcript 105322

• Transcript: Ll_transcript_380990
• CDS coordinates: 283-1113 (+)
• Peptide sequence: MQDTKKNQQKQKQVVVNEESKKKERHIVTWNKEEDDILREQISTHGTENWTIIASKFKDKTTRQCRRRWYTYLNSDFKKGGWSPEEDMLLCEAQKVFGNRWTEIAKVVSGRTDNAVKNRFSTLCKKRAKYEALAKENNISFINSNNKRVILQHGYNTDTALESAVANKKTRRSHIPDNGAENIGFGDRSHKQNGTPLNQQSRAPFAELPQNSHNVNILPAQNNKIQGTFLKKDDPKISALMQQAELLSSLALKVDVKNMDQSLENAWKVRLDSFCT*
• ORF Type: complete

Annotations of Ll_transcript_380990

• Blastp: Transcription factor MYB88 from Arabidopsis with 61.75% of identity
• Blastx: Transcription factor MYB88 from Arabidopsis with 63.36% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT2G02820)
• CantataDB: Link to cantataDB annotations (CNT0002598)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432050.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;