Transcript | Ll_transcript_379862 |
---|---|
CDS coordinates | 3-368 (+) |
Peptide sequence | MSTTTLHSTYHLKLTDSTRPHTTRKRKPNELPFKETQQGFVDYDNGHHDVSNKVTGILKDGIPARYRIRVAGNRFQKDWTVSEVVELVLSLDLSDDIDGLLNRWVGRFARKNFPYLIKVQA* |
ORF Type | complete |
Blastp | Pentatricopeptide repeat-containing protein At2g41720 from Arabidopsis with 50.48% of identity |
---|---|
Blastx | Pentatricopeptide repeat-containing protein At2g41720 from Arabidopsis with 50.48% of identity |
Eggnog | Pentatricopeptide repeat-containing protein(ENOG410Z7Z7) |
Kegg | Link to kegg annotations (AT2G41720) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434154.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer