Protein coding transcript 105360

• Transcript: Ll_transcript_379862
• CDS coordinates: 3-368 (+)
• Peptide sequence: MSTTTLHSTYHLKLTDSTRPHTTRKRKPNELPFKETQQGFVDYDNGHHDVSNKVTGILKDGIPARYRIRVAGNRFQKDWTVSEVVELVLSLDLSDDIDGLLNRWVGRFARKNFPYLIKVQA*
• ORF Type: complete

Annotations of Ll_transcript_379862

• Blastp: Pentatricopeptide repeat-containing protein At2g41720 from Arabidopsis with 50.48% of identity
• Blastx: Pentatricopeptide repeat-containing protein At2g41720 from Arabidopsis with 50.48% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT2G41720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434154.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;