Transcript | Ll_transcript_380388 |
---|---|
CDS coordinates | 1241-1576 (+) |
Peptide sequence | MRHLVLFVERNLEEKDIIRLGFFSQPDGPLLGNGSFKSSLLVPGIKEGFYLGPPPKDKLPKNSPQGSVLVGAISYGKLSVADQGENKNPEKHPASYRVSYIVPPNKIDEDKV |
ORF Type | 3prime_partial |
Blastp | Tripeptidyl-peptidase 2 from Arabidopsis with 63.96% of identity |
---|---|
Blastx | Tripeptidyl-peptidase 2 from Arabidopsis with 62.99% of identity |
Eggnog | peptidase (S8 and S53, subtilisin, kexin, sedolisin(COG1404) |
Kegg | Link to kegg annotations (AT4G20850) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453181.1) |
Pfam | Tripeptidyl peptidase II (PF12580.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer