Protein coding transcript 105375

• Transcript: Ll_transcript_380398
• CDS coordinates: 612-1019 (+)
• Peptide sequence: MWDFKHLPRKMYFFRHDNVQILEKMRHLVLFVERNLEEKDIIRLGFFSQPDGPLLGNGSFKSSLLVPGIKEGFYLGPPPKDKLPKNSPQGSVLVGAISYGKLSVADQGENKNPEKHPASYRVSYIVPPNKIDEDKV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_380398

• Blastp: Tripeptidyl-peptidase 2 from Arabidopsis with 60.9% of identity
• Blastx: Tripeptidyl-peptidase 2 from Arabidopsis with 60.9% of identity
• Eggnog: peptidase (S8 and S53, subtilisin, kexin, sedolisin(COG1404)
• Kegg: Link to kegg annotations (AT4G20850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453181.1)
• Pfam: Tripeptidyl peptidase II (PF12580.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;