Protein coding transcript 105387

• Transcript: Ll_transcript_380414
• CDS coordinates: 218-598 (+)
• Peptide sequence: MPCASFTSGPGSATAADGDNNNNNNGDGYFSVRDFKLNESTFLASLMPKKEIGVDRFFEAHPNYDGRGVLIAIFDSGIDPAAAGLQVTSDGKPKVLDVIDCTGSGDVDISKVVKADADGCISGASG*
• ORF Type: complete

Annotations of Ll_transcript_380414

• Blastp: Tripeptidyl-peptidase 2 from Oryza sativa with 82.61% of identity
• Blastx: Tripeptidyl-peptidase 2 from Arabidopsis with 80.21% of identity
• Eggnog: peptidase (S8 and S53, subtilisin, kexin, sedolisin(COG1404)
• Kegg: Link to kegg annotations (4330237)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453181.1)
• Pfam: Subtilase family (PF00082.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;